PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013608113.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family EIL
Protein Properties Length: 605aa    MW: 68550.2 Da    PI: 5.3453
Description EIL family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013608113.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1EIN3495.82.3e-151514091353
                     XXXXXXXXXXXXXXXXXXXXXXX..XXXXX..XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX CS
            EIN3   1 eelkkrmwkdqmllkrlkerkkqlledkeaa.tgakksnksneqarrkkmsraQDgiLkYMlkemevcnaqGfvYgiipekgkpvegasdsLraW 94 
                     +el++rmw+d+m+lkrlke+++++  +k+    +++k+++s+eqarrkkmsraQDgiLkYMlk+mevc+aqGfvYgiipe+gkpv+gasd+Lr+W
  XP_013608113.1  51 DELERRMWRDKMRLKRLKEQQQDNKSSKQGVdYDSAKQRQSQEQARRKKMSRAQDGILKYMLKMMEVCKAQGFVYGIIPENGKPVTGASDNLREW 145
                     79*******************9987777765699************************************************************* PP

                     XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX....XX----STTS-HHHHHHHHHHHSSSSSS-TTS--TTT--HHHH---S--HHHHHHT--TT CS
            EIN3  95 WkekvefdrngpaaiskyqaknlilsgesslqtersseshslselqDTtlgSLLsalmqhcdppqrrfplekgvepPWWPtGkelwwgelglskd 189
                     Wk+kv+fdrngpaai+kyqa+n++++  +s+      ++h+l+elqDTtlgSLLsalmqhcdppqrrfplekgv+pPWWP+Gke+ww +lgl kd
  XP_013608113.1 146 WKDKVRFDRNGPAAIAKYQAENNVPGVCESNGL-IGPTPHTLQELQDTTLGSLLSALMQHCDPPQRRFPLEKGVPPPWWPSGKEDWWCQLGLGKD 239
                     *************************98877766.9************************************************************ PP

                     --.-----GGG--HHHHHHHHHHHHHHTGGGHHHHHHTTTTSSSSTTT--SHHHHHHHHHHTTTTT-S--XXXX..XX..XXXX.XXXXXXXXXX CS
            EIN3 190 qgtppykkphdlkkawkvsvLtavikhmsptieeirelerqskylqdkmsakesfallsvlnqeekecatvsah..ss..slrk.qspkvtlsce 279
                     qg+ pykkphdlkkawkv+vLtavikhm p++ +ir+l+rqsk+lqdkm+akes+++l+++nqee+++++++++  ++  sl+  ++ ++ +++ 
  XP_013608113.1 240 QGPAPYKKPHDLKKAWKVGVLTAVIKHMFPDVGKIRKLVRQSKCLQDKMTAKESATWLAIINQEEALARELYPEscPPlsSLSGgGNCSLLMNDC 334
                     **************************************************************************65226544446999999**** PP

                     XXXXXX...XXXXXX.XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX......XXXXXXX.XXXXXXXXXXXXXXXX CS
            EIN3 280 qkedve...gkkeskikhvqavkttagfpvvrkrkkkpsesakvsskevsrtcqssqfrgsetelifadknsisqne 353
                      ++dve   ++ + ++++v+ vk++ + ++ rkrk +++ +a ++ +  + tc++  + +se + +f d+ns+++++
  XP_013608113.1 335 GQYDVEgfeKETRYEVEEVKPVKEEVSSEFMRKRKPNRDLNAVMERT--VFTCENPGCVHSEISRGFLDRNSRDNHQ 409
                     ******86555555667788888888999*****9666666666544..7*************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF048731.1E-12951304No hitNo description
Gene3DG3DSA:1.10.3180.101.2E-73180314IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
SuperFamilySSF1167682.09E-60183307IPR023278Ethylene insensitive 3-like protein, DNA-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 605 aa     Download sequence    Send to blast
MMFNEMGMLG GNVDFYSCSS LGELDLCPAP QPELDSIVED DYTDDDEIDV DELERRMWRD  60
KMRLKRLKEQ QQDNKSSKQG VDYDSAKQRQ SQEQARRKKM SRAQDGILKY MLKMMEVCKA  120
QGFVYGIIPE NGKPVTGASD NLREWWKDKV RFDRNGPAAI AKYQAENNVP GVCESNGLIG  180
PTPHTLQELQ DTTLGSLLSA LMQHCDPPQR RFPLEKGVPP PWWPSGKEDW WCQLGLGKDQ  240
GPAPYKKPHD LKKAWKVGVL TAVIKHMFPD VGKIRKLVRQ SKCLQDKMTA KESATWLAII  300
NQEEALAREL YPESCPPLSS LSGGGNCSLL MNDCGQYDVE GFEKETRYEV EEVKPVKEEV  360
SSEFMRKRKP NRDLNAVMER TVFTCENPGC VHSEISRGFL DRNSRDNHQL GCPHRDSCVL  420
YGAGPSRFHV NEVKPVVGFS QPRPVNSVDQ PIDLTGIGVP EDGQKMISEL MSMYDRNVQS  480
NQTPMVMENQ NVSLLQPMVQ NQFQGNMVEG GFFEEFNIPN RAKNNNSSNQ MFFQGNNNGF  540
NYDTAHNNNF EVAHNNSSSN RFQGVYDSAP FDMASLVYRD DMSVPGVVGT MDGMQQKQHD  600
VSMWF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4zds_A3e-871823142134Protein ETHYLENE INSENSITIVE 3
4zds_B3e-871823142134Protein ETHYLENE INSENSITIVE 3
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bol.37270.0leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013608113.10.0PREDICTED: protein ETHYLENE INSENSITIVE 3-like
RefseqXP_013608117.10.0PREDICTED: protein ETHYLENE INSENSITIVE 3-like
RefseqXP_013678568.10.0PREDICTED: protein ETHYLENE INSENSITIVE 3-like
RefseqXP_013678569.10.0PREDICTED: protein ETHYLENE INSENSITIVE 3-like
SwissprotO246060.0EIN3_ARATH; Protein ETHYLENE INSENSITIVE 3
TrEMBLA0A0D3AC060.0A0A0D3AC06_BRAOL; Uncharacterized protein
STRINGfgenesh2_kg.3__2304__AT3G20770.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM21352879
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G20770.10.0EIL family protein